PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016494917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 338aa    MW: 38920.3 Da    PI: 8.4061
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016494917.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.42.6e-136761898
                    --HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3 18 lpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                    +p  f+ ++  g++   +++  +  ++g++W vkl  ++++    +++GW eF+++++L+ gD++vF+++g++ef   v++f 
  XP_016494917.1  6 IPIGFL-KYlkGYD---HIEHAVLKRDGKKWLVKL--TGRR----FEAGWAEFAEEHDLQLGDMLVFRHEGNMEF--DVSIFG 76
                    677777.4444333...456788999*********..8887....9***********************999999..888886 PP

2B350.34.3e-16123210495
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                      +++++  ++g l+lpk+fa ++g+ +++   l+++de+ rsW+++l  + +++++++++ W eF  an++k+g  ++F+++++ ++++v k
  XP_016494917.1 123 CTVKPYCVTNGFLRLPKQFAWANGLANKK-CGLIIRDERQRSWDLRL--TTYGSQVYMGGRWGEFRAANDIKVGNYIMFEVVSN-GEQPVWK 210
                     567899999**************666433.46999************..9***9**************************8875.4445555 PP

3B356.74.3e-18232321598
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     +++++ l++++l++p++fa ++g+++++  +l+++de+ rsW+++l  r  + ++ +++GW eF + n LkegD +vF+++  +++++  +++r
  XP_016494917.1 232 TIRPYCLSNDLLCIPRQFAHANGLINKK-CDLIIRDERQRSWSLRL--RSFGTGVCIKGGWHEFRDTNCLKEGDHIVFEVVT-NGEKPIWQFRR 321
                     678999****************988654.59***************..999999*************************876.56666766666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.717178IPR003340B3 DNA binding domain
SMARTSM010198.8E-6278IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-16584IPR015300DNA-binding pseudobarrel domain
PfamPF023621.2E-9675IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-15680IPR015300DNA-binding pseudobarrel domain
CDDcd100171.39E-12675No hitNo description
Gene3DG3DSA:2.40.330.101.5E-16118211IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.12E-17118212IPR015300DNA-binding pseudobarrel domain
CDDcd100174.80E-11120199No hitNo description
PROSITE profilePS5086311.364120214IPR003340B3 DNA binding domain
SMARTSM010191.8E-16120215IPR003340B3 DNA binding domain
PfamPF023622.1E-13122209IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-20221322IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.26E-21226325IPR015300DNA-binding pseudobarrel domain
CDDcd100171.46E-13227307No hitNo description
PROSITE profilePS5086312.858228322IPR003340B3 DNA binding domain
SMARTSM010195.2E-17229323IPR003340B3 DNA binding domain
PfamPF023623.5E-16232321IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MASKKIPIGF LKYLKGYDHI EHAVLKRDGK KWLVKLTGRR FEAGWAEFAE EHDLQLGDML  60
VFRHEGNMEF DVSIFGSNHC EREYAEYLEE GEVHTVEETS KNFEFKDAAA ALHNPFGQSY  120
FICTVKPYCV TNGFLRLPKQ FAWANGLANK KCGLIIRDER QRSWDLRLTT YGSQVYMGGR  180
WGEFRAANDI KVGNYIMFEV VSNGEQPVWK FHGKPNPSIN SSSKAFPHFV CTIRPYCLSN  240
DLLCIPRQFA HANGLINKKC DLIIRDERQR SWSLRLRSFG TGVCIKGGWH EFRDTNCLKE  300
GDHIVFEVVT NGEKPIWQFR RNISGENASI SFKGLTEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016494917.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X2
TrEMBLK4CIB31e-136K4CIB3_SOLLC; Uncharacterized protein
STRINGSolyc08g006240.1.11e-136(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.12e-39B3 family protein